PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g107230.1
Common NameMTR_4g107230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 288aa    MW: 32031 Da    PI: 8.6734
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g107230.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.44e-1485129347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r   k+Rt+ q+ s+ qky
  Medtr4g107230.1  85 PWTEEEHKLFLVGLQKVGKGDWRGISRNYVKTRTPTQVASHAQKY 129
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.04878134IPR017930Myb domain
SuperFamilySSF466894.56E-1780135IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-1681132IPR006447Myb domain, plants
SMARTSM007174.6E-982132IPR001005SANT/Myb domain
CDDcd001671.11E-985130No hitNo description
PfamPF002492.2E-1185129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-1085129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSSASTTADS AEFMLFGVRV VVDSMRKSVS MNNLSQYEQQ PQDNIIIKDD NINKDVITAG  60
YASADDAVPQ NSARNRDRER KRGIPWTEEE HKLFLVGLQK VGKGDWRGIS RNYVKTRTPT  120
QVASHAQKYF LRRSNLNRRR RRSSLFDITT DTVSAIPMEE EQVKNQDSVS QLQPLCPAVP  180
ETRKINGFPF MSVYELGVNE STPMEELTLG QGNVKHNFQT NSLFNPIPFV VSDPKASIVS  240
DITSSSSIDP PTLSLGLSFS SDQRKTSSTH LHAMPCFKNG DNIISVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.43500.0flower| glandular trichome| leaf| pod| root| seed| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1388990.0BT138899.1 Medicago truncatula clone JCVI-FLMt-13C5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013457844.10.0MYB-like transcription factor family protein
SwissprotQ2V9B04e-67MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A072V1C40.0A0A072V1C4_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA05G01640.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.22e-57MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]